PPX1, Recombinant, Saccharomyces Cerevisiae, aa1-397, His-Tag (Exopolyphosphatase)

Artikelnummer: USB-374830
Artikelname: PPX1, Recombinant, Saccharomyces Cerevisiae, aa1-397, His-Tag (Exopolyphosphatase)
Artikelnummer: USB-374830
Hersteller Artikelnummer: 374830
Alternativnummer: USB-374830-20,USB-374830-100,USB-374830-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Degradation of inorganic polyphosphates. Source: Full length recombinant protein corresponding to aa1-397 from saccharomyces cerevisiae PPX1, fused to 6XHis-Tag at N-terminal expressed in E. coli. Swiss/UniProt Accession: P38698. Molecular Weight: ~49.1kD Amino Acid Sequence: MSPLRKTVPEFLAHLKSLPISKIASNDVLTICVGNESADMDSIASAITYSYCQYIYNEGTYSEEKKKGSFIVPIIDIPREDLSLRRDVMYVLEKLKIKEEELFFIEDLKSLKQNVSQGTELNSYLVDNNDTPKNLKNYIDNVVGIIDHHFDLQKHLDAEPRIVKVSGSCSSLVFNYWYEKLQGDREVVMNIAPLLMGAILIDTSNMRRKVEESDKLAIERCQAVLSGAVNEVSAQGLEDSSEFYKEIKSRKNDIKGFSVSDILKKDYKQFNFQGKGHKGLEIGLSSIVKRMSWLFNEHGGEADFVNQCRRFQAERGLDVLVLLTSWRKAGDSHRELVILGDSNVVRELIERVSDKLQLQLFGGNLDGGVAMFKQLNVEATRKQVVPYLEEAYSNLEE Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 49.1
UniProt: P38698
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a liquid in 20mM Tris-HCl, pH 8.0, 0.5M sodium chloride, 50% glycerol.