PR10A, Recombinant, Coptis Japonica, aa20-196, His-SUMO-Tag (S-norcoclaurine Synthase 2)

Artikelnummer: USB-374831
Artikelname: PR10A, Recombinant, Coptis Japonica, aa20-196, His-SUMO-Tag (S-norcoclaurine Synthase 2)
Artikelnummer: USB-374831
Hersteller Artikelnummer: 374831
Alternativnummer: USB-374831-20,USB-374831-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Involved in the biosynthesis of the common precursor of all benzylisoquinoline alkaloids such as morphine, sanguinarine, codeine or berberine. Condenses dopamine and pyruvic acid or 4-hydroxyphenylpyruvate. Source: Recombinant protein corresponding to aa20-196 from coptis japonica PR10A, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36kD Amino Acid Sequence: ERLIFNGRPLLHRVTKEETVMLYHELEVAASADEVWSVEGSPELGLHLPDLLPAGIFAKFEITGDGGEGSILDMTFPPGQFPHHYREKFVFFDHKNRYKLVEQIDGDFFDLGVTYYMDTIRVVATGPDSCVIKSTTEYHVKPEFAKIVKPLIDTVPLAIMSEAIAKVVLENKHKSSE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 36
UniProt: A2A1A1
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.