PrgJ, Recombinant, Salmonella Typhimurium, aa1-101, His-SUMO-Tag/Myc-Tag (Protein PrgJ)

Artikelnummer: USB-374846
Artikelname: PrgJ, Recombinant, Salmonella Typhimurium, aa1-101, His-SUMO-Tag/Myc-Tag (Protein PrgJ)
Artikelnummer: USB-374846
Hersteller Artikelnummer: 374846
Alternativnummer: USB-374846-20,USB-374846-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Required for invasion of epithelial cells. Source: Recombinant protein corresponding to aa1-101 from salmonella typhimurium Protein PrgJ, fused to His-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~15.9kD Amino Acid Sequence: MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 15.9
UniProt: P41785
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.