PRIM1, Recombinant, Human, aa1-420, His-SUMO-Tag (DNA Primase Small Subunit)

Produktübersicht

• Artikelname: PRIM1, Recombinant, Human, aa1-420, His-SUMO-Tag (DNA Primase Small Subunit)
• Artikelnummer: USB-374848
• Hersteller Artikelnummer: 374848
• Alternativnummer: USB-374848-20,USB-374848-100,USB-374848-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

DNA primase is the polymerase that synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication. Source: Recombinant protein corresponding to aa1-420 from human PRIM1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~65.9kD Amino Acid Sequence: METFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENKESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWEIMLQYCFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAISTNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEHFLENLDKSRKGELLKKSDLQKDF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 65.9
• UniProt: P49642
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.