PRKRIR, Recombinant, Human, aa612-761, His-SUMO-Tag (52kD Repressor of The Inhibitor of the Protein Kinase)

Produktübersicht

• Artikelname: PRKRIR, Recombinant, Human, aa612-761, His-SUMO-Tag (52kD Repressor of The Inhibitor of the Protein Kinase)
• Artikelnummer: USB-374853
• Hersteller Artikelnummer: 374853
• Alternativnummer: USB-374853-20,USB-374853-100,USB-374853-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Upstream regulator of interferon-induced serine/threonine protein kinase R (PKR). May block the PKR-inhibitory function of P58IPK, resulting in restoration of kinase activity and suppression of cell growth. Source: Recombinant protein corresponding to aa612-761 from human PRKRIR, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33.6kD Amino Acid Sequence: MGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 33.6
• UniProt: O43422
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.