PRL, Recombinant, Porcine, aa31-229, His-Tag (Prolactin)

Artikelnummer: USB-374855
Artikelname: PRL, Recombinant, Porcine, aa31-229, His-Tag (Prolactin)
Artikelnummer: USB-374855
Hersteller Artikelnummer: 374855
Alternativnummer: USB-374855-20,USB-374855-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Prolactin acts primarily on the mammary gland by promoting lactation. Source: Recombinant protein corresponding to aa31-229 from porcine PRL, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~24.9kD Amino Acid Sequence: LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 24.9
UniProt: P01238
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.