Probable alpha-Galactosidase B, Recombinant, Aspergillus Niger, aa21-443, His-Tag (AglB)

Artikelnummer: USB-374859
Artikelname: Probable alpha-Galactosidase B, Recombinant, Aspergillus Niger, aa21-443, His-Tag (AglB)
Artikelnummer: USB-374859
Hersteller Artikelnummer: 374859
Alternativnummer: USB-374859-20,USB-374859-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Hydrolyzes a variety of simple alpha-D-galactoside as well as more complex molecules such as oligosaccharides and polysaccharides. Recombinant protein corresponding to aa21-443 from aspergillus niger Probable alpha-Galactosidase B, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~48.7kD Amino Acid Sequence: DGVGRTPALGWNSWNAYSCDIDADKIVTAANEVVNLGLKDLGYEYINIDDCWSVKSGRNTTTKRIIPDPDKFPNGISGVADQVHALGLKLGIYSSAGLTTCAGYPASLGYEEIDAQSFAEWGIDYLKYDNCGVPTNLTDQYTYCVPDSTDGSNYPNGTCVNLTDAAPQGYDWATSTTAKRYQRMRDALLSVNRTILYSLCDWGQADVNAWGNATGNSWRMSGDITATWSRIAEIANENSFLMNYANFWGYPDPDMLEVGNGNLTLPENRAHFALWAMMKAPLIIGTPLDSIDTSHLTILSNKPLLTFHQDAVIGRPAYPYKWGYNPDWTFDPEHPAEYWSGPTSSGEVFVLMLNSEGEVKTRSAVWEEVPELKDRGTKKNSKEKKGFKVTDAWTGKDLGCVKDKYEVKLQAHDVAVLVVGGQC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 48.7
UniProt: A2QEJ9
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.