Prss1, Recombinant, Rat, aa24-246, His-SUMO-Tag (Anionic Trypsin-1)

Artikelnummer: USB-374890
Artikelname: Prss1, Recombinant, Rat, aa24-246, His-SUMO-Tag (Anionic Trypsin-1)
Artikelnummer: USB-374890
Hersteller Artikelnummer: 374890
Alternativnummer: USB-374890-20,USB-374890-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa24-246 from rat Prss1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.6kD Amino Acid Sequence: IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 39.6
UniProt: P00762
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.