PSCA, Recombinant, Human, aa21-95, His-Tag (Prostate Stem Cell Antigen)

Artikelnummer: USB-374901
Artikelname: PSCA, Recombinant, Human, aa21-95, His-Tag (Prostate Stem Cell Antigen)
Artikelnummer: USB-374901
Hersteller Artikelnummer: 374901
Alternativnummer: USB-374901-20,USB-374901-100
Hersteller: US Biological
Kategorie: Molekularbiologie
May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro. Source: Recombinant protein corresponding to aa21-95 from human PSCA, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~10.2kD Amino Acid Sequence: LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 10.2
UniProt: O43653
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.