PSMB3, Recombinant, Human, aa1-205, GST-Tag (Proteasome Subunit beta Type-3)

Artikelnummer: USB-374909
Artikelname: PSMB3, Recombinant, Human, aa1-205, GST-Tag (Proteasome Subunit beta Type-3)
Artikelnummer: USB-374909
Hersteller Artikelnummer: 374909
Alternativnummer: USB-374909-20,USB-374909-100,USB-374909-1
Hersteller: US Biological
Kategorie: Molekularbiologie
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Source: Recombinant protein corresponding to aa1-205 from human PSMB3, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~49.8kD Amino Acid Sequence: SIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 49.8
UniProt: P49720
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.