PSME1, Recombinant, Human, aa1-249, GST-Tag (Proteasome Activator Complex Subunit 1)

Artikelnummer: USB-374914
Artikelname: PSME1, Recombinant, Human, aa1-249, GST-Tag (Proteasome Activator Complex Subunit 1)
Artikelnummer: USB-374914
Hersteller Artikelnummer: 374914
Alternativnummer: USB-374914-20,USB-374914-100,USB-374914-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Implicated in immunoproteasome assembly and required for efficient antigen processing. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome. Source: Recombinant protein corresponding to aa1-249 from human PSME1, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~55.7kD Amino Acid Sequence: MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 55.7
UniProt: Q06323
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.