PTH2R, Recombinant, Human, aa27-145, His-SUMO-Tag (Parathyroid Hormone 2 Receptor)

Artikelnummer: USB-374923
Artikelname: PTH2R, Recombinant, Human, aa27-145, His-SUMO-Tag (Parathyroid Hormone 2 Receptor)
Artikelnummer: USB-374923
Hersteller Artikelnummer: 374923
Alternativnummer: USB-374923-20,USB-374923-100,USB-374923-1
Hersteller: US Biological
Kategorie: Molekularbiologie
This is a specific receptor for parathyroid hormone. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. PTH2R may be responsible for PTH effects in a number of physiological systems. It may play a significant role in pancreatic function. PTH2R presence in neurons indicates that it may function as a neurotransmitter receptor. Source: Recombinant protein corresponding to aa27-145 from human PTH2R, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.6kD Amino Acid Sequence: DSDGTITIEEQIVLVLKAKVQCELNITAQLQEGEGNCFPEWDGLICWPRGTVGKISAVPCPPYIYDFNHKGVAFRHCNPNGTWDFMHSLNKTWANYSDCLRFLQPDISIGKQEFFERLY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 29.6
UniProt: P49190
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.