Putative invertase Inhibitor, Recombinant, Platanus Acerifolia, aa24-179, His-Tag

Artikelnummer: USB-374945
Artikelname: Putative invertase Inhibitor, Recombinant, Platanus Acerifolia, aa24-179, His-Tag
Artikelnummer: USB-374945
Hersteller Artikelnummer: 374945
Alternativnummer: USB-374945-20, USB-374945-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Invertase inhibitor. Source: Recombinant protein corresponding to aa24-179 from platanus acerifolia Putative invertase inhibitor, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~18.6kD Amino Acid Sequence: ADIVQGTCKKVAQRSPNVNYDFCVKSLGADPKSHTADLQGLGVISANLAIQHGSKIQTFIGRILKSKVDPALKKYLNDCVGLYADAKSSVQEAIADFKSKDYASANVKMSAALDDSVTCEDGFKEKKGIVSPVTKENKDYVQLTAISLAITKLLGA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 18.6
UniProt: Q8GT41
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.