QPCTL, Recombinant, Human, aa212-382, His-SUMO-Tag (Glutaminyl-peptide Cyclotransferase-like Protein)

Artikelnummer: USB-374963
Artikelname: QPCTL, Recombinant, Human, aa212-382, His-SUMO-Tag (Glutaminyl-peptide Cyclotransferase-like Protein)
Artikelnummer: USB-374963
Hersteller Artikelnummer: 374963
Alternativnummer: USB-374963-20,USB-374963-100,USB-374963-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Responsible for the biosynthesis of pyroglutamyl peptides. Source: Recombinant protein corresponding to aa212-382 from human QPCTL, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.5kD Amino Acid Sequence: AAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFYSHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLISTPFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYLGL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 35.5
UniProt: Q9NXS2
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.