RAB5C, Recombinant, Human, aa1-261, His-SUMO-Tag (Ras-related Protein Rab-5C)

Artikelnummer: USB-374975
Artikelname: RAB5C, Recombinant, Human, aa1-261, His-SUMO-Tag (Ras-related Protein Rab-5C)
Artikelnummer: USB-374975
Hersteller Artikelnummer: 374975
Alternativnummer: USB-374975-20,USB-374975-100,USB-374975-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Protein transport. Probably involved in vesicular traffic. Source: Recombinant protein corresponding to aa1-216 from human RAB5C, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.5kD Amino Acid Sequence: MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 39.5
UniProt: P51148
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.