RDH11, Recombinant, Human, aa22-318, His-SUMO-Tag (Retinol Dehydrogenase 11)

Artikelnummer: USB-375016
Artikelname: RDH11, Recombinant, Human, aa22-318, His-SUMO-Tag (Retinol Dehydrogenase 11)
Artikelnummer: USB-375016
Hersteller Artikelnummer: 375016
Alternativnummer: USB-375016-20,USB-375016-100,USB-375016-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Exhibits an oxidoreductive catalytic activity towards retinoids. Most efficient as an NADPH-dependent retinal reductase. Displays high activity towards 9-cis and all-trans-retinol. Also involved in the metabolism of short-chain aldehydes. No steroid dehydrogenase activity detected. Source: Recombinant protein corresponding to aa22-318 from human RDH11, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~49kD Amino Acid Sequence: PQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 49
UniProt: Q8TC12
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.