RecR, Recombinant, Mycobacterium Tuberculosis, aa1-203, His-Tag (Recombination protein RecR)

Produktübersicht

• Artikelname: RecR, Recombinant, Mycobacterium Tuberculosis, aa1-203, His-Tag (Recombination protein RecR)
• Artikelnummer: USB-375022
• Hersteller Artikelnummer: 375022
• Alternativnummer: USB-375022-20,USB-375022-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

May play a role in DNA repair. It seems to be involved in an RecBC-independent recombinational process of DNA repair. It may act with RecF and RecO. Source: Recombinant protein corresponding to aa1-203 from mycobacterium tuberculosis recR, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~26.1kD Amino Acid Sequence: MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPSDIDRLTGVLAKVRDGVRFCAVCGNVSDNERCRICSDIRRDASVVCIVEEPKDIQAVERTREFRGRYHVLGGALDPLSGIGPDQLRIRELLSRIGERVDDVDVTEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPMGGDLEFADELTLGRALAGRRVLA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 26.1
• UniProt: A5U941
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.