Reg3b, Recombinant, Rat, aa27-175, His-Tag (Regenerating Islet-derived Protein 3-beta)

Produktübersicht

• Artikelname: Reg3b, Recombinant, Rat, aa27-175, His-Tag (Regenerating Islet-derived Protein 3-beta)
• Artikelnummer: USB-375025
• Hersteller Artikelnummer: 375025
• Alternativnummer: USB-375025-20,USB-375025-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Bactericidal C-type lectin which acts against several intestinal Gram-positive bacteria and Gram-negative bacteria. Lacks antibacterial activity against S.typhimurium. May play a role in protection against infection with S.enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues. Source: Recombinant protein corresponding to aa27-175 from rat Reg3b, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~20.6kD Amino Acid Sequence: EDSPKKIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPEGHLVSVLNVAEASFLASMVKNTGNSYQYTWIGLHDPTLGGEPNGGGWEWSNNDIMNYVNWERNPSTALDRGFCGSLSRSSGFLRWRDTTCEVKLPYVCKFTG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 20.6
• UniProt: P25031
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.