RELT, Recombinant, Human, aa26-153, His-Tag (Tumor Necrosis Factor Receptor Superfamily Member 19L Protein)

Artikelnummer: USB-375034
Artikelname: RELT, Recombinant, Human, aa26-153, His-Tag (Tumor Necrosis Factor Receptor Superfamily Member 19L Protein)
Artikelnummer: USB-375034
Hersteller Artikelnummer: 375034
Alternativnummer: USB-375034-20,USB-375034-100,USB-375034-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Mediates activation of NF-kappa-B. May play a role in T-cell activation. Source: Recombinant protein corresponding to aa26-153 from human RELT, fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~17.7kD Amino Acid Sequence: STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 17.7
UniProt: Q969Z4
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.