RETNLB, Recombinant, Human, aa24-111, His-Tag (Resistin-like beta)

Artikelnummer: USB-375047
Artikelname: RETNLB, Recombinant, Human, aa24-111, His-Tag (Resistin-like beta)
Artikelnummer: USB-375047
Hersteller Artikelnummer: 375047
Alternativnummer: USB-375047-20, USB-375047-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Probable hormone. Source: Recombinant protein corresponding to aa24-111 from human RETNLB, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~11.4kD AA Sequence: QCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 11.4
UniProt: Q9BQ08
Reinheit: ~90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.