Riboflavin-binding Protein, Recombinant, Chicken, aa18-225, His-Tag

Artikelnummer: USB-375060
Artikelname: Riboflavin-binding Protein, Recombinant, Chicken, aa18-225, His-Tag
Artikelnummer: USB-375060
Hersteller Artikelnummer: 375060
Alternativnummer: USB-375060-20,USB-375060-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Required for the transport of riboflavin to the developing oocyte. Source: Recombinant protein corresponding to aa18-225 from chicken Riboflavin-binding protein, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.9kD Amino Acid Sequence: QQYGCLEGDTHKANPSPEPNMHECTLYSESSCCYANFTEQLAHSPIIKVSNSYWNRCGQLSKSCEDFTKKIECFYRCSPHAARWIDPRYTAAIQSVPLCQSFCDDWYEACKDDSICAHNWLTDWERDESGENHCKSKCVPYSEMYANGTDMCQSMWGESFKVSESSCLCLQMNKKDMVAIKHLLSESSEESSSMSSSEEHACQKKLLK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 27.9
UniProt: P02752
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.