Ribosome-inactivating Protein Karasurin-C, Recombinant, Trichosanthes Kirilowii, aa22-270, His-SUMO-Tag

Artikelnummer: USB-375063
Artikelname: Ribosome-inactivating Protein Karasurin-C, Recombinant, Trichosanthes Kirilowii, aa22-270, His-SUMO-Tag
Artikelnummer: USB-375063
Hersteller Artikelnummer: 375063
Alternativnummer: USB-375063-20,USB-375063-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Abortion-inducing protein. It inactivates eukaryotic 60S ribosomal subunits. Source: Recombinant protein corresponding to aa22-270 from trichosanthes kirilowii Ribosome-inactivating protein karasurin-C, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~43.4kD Amino Acid Sequence: EGDVSFRLSGATSSSYGVFISNLRKALPYERKLYDIPLLRSTLPGSQRYALIHLTNYADETISVAIDVTNVYVMGYRAGDTSYFFNEASATEAAKYVFKDAKRKVTLPYSGNYERLQIAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFETPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 43.4
UniProt: P24478
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.