RPL10A, Recombinant, Human, aa4-215, GST-Tag (60S Ribosomal Protein L10a)

Artikelnummer: USB-375094
Artikelname: RPL10A, Recombinant, Human, aa4-215, GST-Tag (60S Ribosomal Protein L10a)
Artikelnummer: USB-375094
Hersteller Artikelnummer: 375094
Alternativnummer: USB-375094-20,USB-375094-100,USB-375094-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Partial recombinant protein corresponding to aa4-215 from human RPL10A, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~51.2kD Amino Acid Sequence: KVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSVCVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKPQR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 51.2
UniProt: P62906
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.