RPL36AL, Recombinant, Human, aa1-106, GST-Tag (60S Ribosomal Protein L36a-like)

Produktübersicht

• Artikelname: RPL36AL, Recombinant, Human, aa1-106, GST-Tag (60S Ribosomal Protein L36a-like)
• Artikelnummer: USB-375106
• Hersteller Artikelnummer: 375106
• Alternativnummer: USB-375106-20,USB-375106-100,USB-375106-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Belongs to the ribosomal protein L44e family. Source: Recombinant protein corresponding to aa1-106 from RPL36AL, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.5kD Amino Acid Sequence: MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 39.5
• UniProt: Q969Q0
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.