RpsC, Recombinant, E. coli, aa2-233, GST-Tag (30S Ribosomal Protein S3)

Artikelnummer: USB-375147
Artikelname: RpsC, Recombinant, E. coli, aa2-233, GST-Tag (30S Ribosomal Protein S3)
Artikelnummer: USB-375147
Hersteller Artikelnummer: 375147
Alternativnummer: USB-375147-20,USB-375147-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation. Plays a role in mRNA unwinding by the ribosome, possibly by forming part of a processivity clamp. Source: Recombinant protein corresponding to aa2-233 from E. coli RpsC, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~52.9kD Amino Acid Sequence: GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRKGRK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 52.9
UniProt: P0A7V3
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.