RpsH, Recombinant, E. coli, aa2-130, His-Tag (30S Ribosomal Protein S8)

Produktübersicht

• Artikelname: RpsH, Recombinant, E. coli, aa2-130, His-Tag (30S Ribosomal Protein S8)
• Artikelnummer: USB-375151
• Hersteller Artikelnummer: 375151
• Alternativnummer: USB-375151-20,USB-375151-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it helps coordinate assembly of the platform of the 30S subunit. Protein S8 is a translational repressor protein, it controls the translation of the spc operon by binding to its mRNA. Source: Recombinant protein corresponding to aa2-130 from E. coli rpsH, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~18.0kD Amino Acid Sequence: SMQDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVEGDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAVVSTSKGVMTDRAARQAGLGGEIICYVA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 18
• UniProt: P0A7W7
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.