RpsJ, Recombinant, E. coli, aa1-103, GST-Tag 30S Ribosomal Protein S10)

Artikelnummer: USB-375152
Artikelname: RpsJ, Recombinant, E. coli, aa1-103, GST-Tag 30S Ribosomal Protein S10)
Artikelnummer: USB-375152
Hersteller Artikelnummer: 375152
Alternativnummer: USB-375152-20,USB-375152-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Involved in the binding of tRNA to the ribosomes. Source: Recombinant protein corresponding to aa1-103 from E. coli 30S Ribosomal Protein S10, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.7kD Amino Acid Sequence: MQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 38.7
UniProt: P0A7R5
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.