RpsO, Recombinant, E. coli, aa2-89, His-Tag (30S Ribosomal Protein S15)

Artikelnummer: USB-375155
Artikelname: RpsO, Recombinant, E. coli, aa2-89, His-Tag (30S Ribosomal Protein S15)
Artikelnummer: USB-375155
Hersteller Artikelnummer: 375155
Alternativnummer: USB-375155-20,USB-375155-100
Hersteller: US Biological
Kategorie: Molekularbiologie
One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it helps nucleate assembly of the platform of the 30S subunit by binding and bridging several RNA helices of the 16S rRNA. In the E. coli 70S ribosome it has been modeled to contact the 23S rRNA of the 50S subunit forming part of bridge B4. In the two 3.5 A resolved ribosome structures there are minor differences between side-chain conformations. Source: Recombinant protein corresponding to aa2-89 from E. coli rpsO, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~14.1kD Amino Acid Sequence: SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLRR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 14.1
UniProt: P0ADZ4
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.