RpsU, Recombinant, E. coli, aa2-71, GST-Tag (30S Ribosomal Protein S21)

Artikelnummer: USB-375158
Artikelname: RpsU, Recombinant, E. coli, aa2-71, GST-Tag (30S Ribosomal Protein S21)
Artikelnummer: USB-375158
Hersteller Artikelnummer: 375158
Alternativnummer: USB-375158-20,USB-375158-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa2-71 from E. coli RpsU, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.4kD Amino Acid Sequence: PVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHAKKLARENARRTRLY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 35.4
UniProt: P68679
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.