RRAS2, Recombinant, Human, aa1-204, GST-Tag (Ras-related Protein R-Ras2)

Produktübersicht

• Artikelname: RRAS2, Recombinant, Human, aa1-204, GST-Tag (Ras-related Protein R-Ras2)
• Artikelnummer: USB-375160
• Hersteller Artikelnummer: 375160
• Alternativnummer: USB-375160-20,USB-375160-100,USB-375160-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

It is a plasma membrane-associated GTP-binding protein with GTPase activity. Might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins but in an antagonistic fashion. Source: Recombinant protein corresponding to aa1-204 from human RRAS2, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~49.9kD Amino Acid Sequence: AAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 49.9
• UniProt: P62070
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.