S100-A3, Recombinant, Human, aa1-101, GST-Tag (Protein S100A3)

Artikelnummer: USB-375174
Artikelname: S100-A3, Recombinant, Human, aa1-101, GST-Tag (Protein S100A3)
Artikelnummer: USB-375174
Hersteller Artikelnummer: 375174
Alternativnummer: USB-375174-20, USB-375174-100, USB-375174-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Binds both calcium and zinc. May be involved in calcium-dependent cuticle cell differentiation, hair shaft and hair cuticular barrier formation. Source: Recombinant protein corresponding to aa1-101 from human S100A3, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.6kD Amino Acid Sequence: ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 38.6
UniProt: P33764
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.