Salivary Antigen 1, Recombinant, Ctenocephalides Felis, aa19-176, His-SUMO-Tag

Artikelnummer: USB-375196
Artikelname: Salivary Antigen 1, Recombinant, Ctenocephalides Felis, aa19-176, His-SUMO-Tag
Artikelnummer: USB-375196
Hersteller Artikelnummer: 375196
Alternativnummer: USB-375196-20,USB-375196-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa19-176 from ctenocephalides felis Salivary antigen 1, fused to 6xHis-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.1kD Amino Acid Sequence: EDIWKVNKKCTSGGKNQDRKLDQIIQKGQQVKIQNICKLIRDKPHTNQEKEKCMKFCKKVCKGYRGACDGNICYCSRPSNLGPDWKVSKECKDPNNKDSRPTEIVPYRQQLAIPNICKLKNSETNEDSKCKKHCKEKCRGGNDAGCDGNFCYCRPKNK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 34.1
UniProt: Q94424
Reinheit: ~90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.