SAMHD1, Recombinant, Mouse, aa395-626, His-Tag (SAM Domain and HD Domain-containing Protein 1)

Produktübersicht

• Artikelname: SAMHD1, Recombinant, Mouse, aa395-626, His-Tag (SAM Domain and HD Domain-containing Protein 1)
• Artikelnummer: USB-375198
• Hersteller Artikelnummer: 375198
• Alternativnummer: USB-375198-20,USB-375198-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Host restriction nuclease that blocks early-stage virus replication in dendritic and other myeloid cells. Likewise, suppresses LINE-1 retrotransposon activity. May function by reducing the cellular dNTP levels to levels too low for retroviral reverse transcription to occur. May play a role in mediating proinflammatory responses to TNF-alpha signaling. Source: Recombinant protein corresponding to aa395-626 from mouse SAMHD1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~30.6kD Amino Acid Sequence: DIMITDAFLKADPYVEITGTAGKKFRISTAIDDMEAFTKLTDNIFLEVLHSTDPQLSEAQSILRNIECRNLYKYLGETQPKREKIRKEEYERLPQEVAKAKPEKAPDVELKAEDFIVDVINVDYGMEDKNPIDRVHFYCKSNSKQAVRINKEQVSQLLPEKFAEQLIRVYCKKKDGKSLDAAGKHFVQWCALRDFTKPQDGDIIAPLITPLKWNNKTSSCLQEVSKVKTCLK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 30.6
• UniProt: Q60710
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.