SCAMP3, Recombinant, Human, aa2-170, GST-Tag (Secretory Carrier-associated Membrane Protein 3)

Artikelnummer: USB-375215
Artikelname: SCAMP3, Recombinant, Human, aa2-170, GST-Tag (Secretory Carrier-associated Membrane Protein 3)
Artikelnummer: USB-375215
Hersteller Artikelnummer: 375215
Alternativnummer: USB-375215-20,USB-375215-100,USB-375215-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Functions in post-Golgi recycling pathways. Acts as a recycling carrier to the cell surface. Source: Recombinant protein corresponding to aa2-170 from human SCAMP3, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~45.9kD Amino Acid Sequence: AQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYYL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 45.9
UniProt: O14828
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.