SCP2, Recombinant, Human, aa1-143, GST-Tag (Non-specific Lipid-transfer Protein)

Artikelnummer: USB-375224
Artikelname: SCP2, Recombinant, Human, aa1-143, GST-Tag (Non-specific Lipid-transfer Protein)
Artikelnummer: USB-375224
Hersteller Artikelnummer: 375224
Alternativnummer: USB-375224-20,USB-375224-100,USB-375224-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Mediates in vitro the transfer of all common phospholipids, cholesterol and gangliosides between membranes. May play a role in regulating steroidogenesis. Source: Recombinant protein corresponding to a1-143 from human SCP2, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.4kD Amino Acid Sequence: MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 42.4
UniProt: P22307
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.