Scrg1, Recombinant, Mouse, aa21-98, His-Tag (Scrapie-responsive Protein 1)

Artikelnummer: USB-375227
Artikelname: Scrg1, Recombinant, Mouse, aa21-98, His-Tag (Scrapie-responsive Protein 1)
Artikelnummer: USB-375227
Hersteller Artikelnummer: 375227
Alternativnummer: USB-375227-20,USB-375227-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa21-98 from mouse Scrg1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~11.0kD Amino Acid Sequence: MPSSRLSCYRKLLKDRNCHNLPEGRADLKLIDANVQHHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 11
UniProt: O88745
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.