Scyb11, Recombinant, Mouse, aa22-98, His-Tag (C-X-C Motif Chemokine 11)

Artikelnummer: USB-375228
Artikelname: Scyb11, Recombinant, Mouse, aa22-98, His-Tag (C-X-C Motif Chemokine 11)
Artikelnummer: USB-375228
Hersteller Artikelnummer: 375228
Alternativnummer: USB-375228-20,USB-375228-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses. Recombinant protein corresponding to aa22-98 from mouse C-X-C Motif Chemokine 11, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~12.9kD Amino Acid Sequence: FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 12.9
UniProt: Q9JHH5
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.