Selt, Recombinant, Mouse, aa20-195, His-Tag (Selenoprotein T)

Artikelnummer: USB-375243
Artikelname: Selt, Recombinant, Mouse, aa20-195, His-Tag (Selenoprotein T)
Artikelnummer: USB-375243
Hersteller Artikelnummer: 375243
Alternativnummer: USB-375243-20,USB-375243-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa20-195 from mouse Selenoprotein T, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.2kD Amino Acid Sequence: SANLGGVPSKRLKMQYATGPLLKFQICVSUGYRRVFEEYMRVISQRYPDIRIEGENYLPQPIYRHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIWQWGQENKVYACMMVFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMDSIPHHRS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 24.2
UniProt: P62342
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.