SNRPB2, Recombinant, Human, aa1-225, His-SUMO-Tag (U2 Small Nuclear Ribonucleoprotein B)

Produktübersicht

• Artikelname: SNRPB2, Recombinant, Human, aa1-225, His-SUMO-Tag (U2 Small Nuclear Ribonucleoprotein B)
• Artikelnummer: USB-375358
• Hersteller Artikelnummer: 375358
• Alternativnummer: USB-375358-20,USB-375358-100,USB-375358-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Involved in pre-mRNA splicing. This protein is associated with snRNP U2. It binds stem loop IV of U2 snRNA only in presence of the U2A protein. Source: Recombinant protein corresponding to aa1-225 from human SNRPB2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.5kD Amino Acid Sequence: MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 41.5
• UniProt: P08579
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.