Sry, Recombinant Mouse, aa1-144, His-Tag (Sex-determining Region Y Protein)

Artikelnummer: USB-375414
Artikelname: Sry, Recombinant Mouse, aa1-144, His-Tag (Sex-determining Region Y Protein)
Artikelnummer: USB-375414
Hersteller Artikelnummer: 375414
Alternativnummer: USB-375414-20,USB-375414-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Transcriptional regulator that controls a genetic switch in male development. It is necessary and sufficient for initiating male sex determination by directing the development of supporting cell precursors (pre-Sertoli cells) as Sertoli rather than granulosa cells. In male adult brain involved in the maintenance of motor functions of dopaminergic neurons. Involved in different aspects of gene regulation including promoter activation or repression. SRY HMG box recognizes DNA by partial intercalation in the minor groove. Promotes DNA bending. Also involved in pre-mRNA splicing. Binds to the DNA consensus sequence 5-[AT]AACAA[AT]-3. Source: Recombinant protein corresponding to aa1-144 from mouse Sry, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~21.2kD Amino Acid Sequence: MEGHVKRPMNAFMVWSRGERHKLAQQNPSMQNTEISKQLGCRWKSLTEAEKRPFFQEAQRLKILHREKYPNYKYQPHRRAKVSQRSGILQPAVASTKLYNLLQWDRNPHAITYRQDWSRAAHLYSKNQQSFYWQPVDIPTGHLQ Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer
Molekulargewicht: 21.2
UniProt: Q05738
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.