Sso7d, Recombinant, Sulfolobus Solfataricus, aa2-64, His-SUMO-Tag (DNA-binding Protein 7d)

Artikelnummer: USB-375421
Artikelname: Sso7d, Recombinant, Sulfolobus Solfataricus, aa2-64, His-SUMO-Tag (DNA-binding Protein 7d)
Artikelnummer: USB-375421
Hersteller Artikelnummer: 375421
Alternativnummer: USB-375421-20,USB-375421-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Constrain negative DNA supercoils, may be involved in maintaining the integrity of their genome at high temperature. Stimulates the Holliday junction cleavage activity of Hjc. Source: Recombinant protein corresponding to aa2-64 from sulfolobus solfataricus DNA-binding Protein 7d, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~23.1kD Amino Acid Sequence: ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 23.1
UniProt: P39476
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.