Thy-1, Recombinant, Mouse, aa20-131, His-SUMO-Tag (Thy1 Membrane Glycoprotein)

Artikelnummer: USB-375564
Artikelname: Thy-1, Recombinant, Mouse, aa20-131, His-SUMO-Tag (Thy1 Membrane Glycoprotein)
Artikelnummer: USB-375564
Hersteller Artikelnummer: 375564
Alternativnummer: USB-375564-20, USB-375564-100
Hersteller: US Biological
Kategorie: Molekularbiologie
May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain. Source: Recombinant protein corresponding to aa20-131 from mouse Thy1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~28.8kD Amino Acid Sequence: QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 28.8
UniProt: P01831
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.