TIMM10B, Recombinant, Human, aa1-103, His-SUMO-Tag (Mitochondrial Import Inner Membrane Translocase Subunit Tim10 B)

Artikelnummer: USB-375570
Artikelname: TIMM10B, Recombinant, Human, aa1-103, His-SUMO-Tag (Mitochondrial Import Inner Membrane Translocase Subunit Tim10 B)
Artikelnummer: USB-375570
Hersteller Artikelnummer: 375570
Alternativnummer: USB-375570-20, USB-375570-100, USB-375570-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex forms a twin-pore translocase that uses the membrane potential as the external driving force. In the TIM22 complex, it may act as a docking point for the soluble 70 kDa complex that guides the target proteins in transit through the aqueous mitochondrial intermembrane space. Source: Recombinant protein corresponding to aa1-103 from human TIMM10B, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.6kD Amino Acid Sequence: MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 27.6
UniProt: Q9Y5J6
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.