TIMM17A, Recombinant, Human, aa1-171, GST-Tag (Mitochondrial Import Inner Membrane Translocase Subunit Tim17-A)

Produktübersicht

• Artikelname: TIMM17A, Recombinant, Human, aa1-171, GST-Tag (Mitochondrial Import Inner Membrane Translocase Subunit Tim17-A)
• Artikelnummer: USB-375571
• Hersteller Artikelnummer: 375571
• Alternativnummer: USB-375571-20, USB-375571-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Source: Recombinant protein corresponding to aa1-171 from human TIMM17A, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~45.0kD Amino Acid Sequence: MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 45
• UniProt: Q99595
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.