TIRAP, Recombinant, Human, aa1-239, GST-Tag (Toll/interleukin-1 Receptor Domain-containing Adapter Protein)

Produktübersicht

• Artikelname: TIRAP, Recombinant, Human, aa1-239, GST-Tag (Toll/interleukin-1 Receptor Domain-containing Adapter Protein)
• Artikelnummer: USB-375583
• Hersteller Artikelnummer: 375583
• Alternativnummer: USB-375583-20,USB-375583-100,USB-375583-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism. Adenylate kinase activity is critical for regulation of the phosphate utilization and the AMP de novo biosynthesis pathways. Plays a key role in hematopoiesis. Source: Recombinant protein corresponding to aa1-239 from human TIRAP, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~53.5kD Amino Acid Sequence: MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 53.5
• UniProt: P58753
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.