TJP1, Recombinant, Canine, aa1633-1769, His-Tag (Tight Junction Protein ZO-1)

Produktübersicht

• Artikelname: TJP1, Recombinant, Canine, aa1633-1769, His-Tag (Tight Junction Protein ZO-1)
• Artikelnummer: USB-375585
• Hersteller Artikelnummer: 375585
• Alternativnummer: USB-375585-20, USB-375585-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

The N-terminal may be involved in transducing a signal required for tight junction assembly, while the C-terminal may have specific properties of tight junctions. The alpha domain might be involved in stabilizing junctions. Plays a role in the regulation of cell migration by targeting CDC42BPB to the leading edge of migrating cells. Source: Recombinant protein corresponding to aa1633-1769 from canine TJP1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~18.7kD Amino Acid Sequence: VVATARGVFNNNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSGDPKTWQNKCLPGDPNYLVGANCVSVLIDHF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Produkteigenschaften

• Molekulargewicht: 18.7
• UniProt: O97758
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.