TJP1, Recombinant, Canine, aa1633-1769, His-Tag (Tight Junction Protein ZO-1)
Artikelnummer:
USB-375585
Hersteller Artikelnummer:
375585
Alternativnummer:
USB-375585-20, USB-375585-100
Hersteller:
US Biological
Kategorie:
Molekularbiologie
The N-terminal may be involved in transducing a signal required for tight junction assembly, while the C-terminal may have specific properties of tight junctions. The alpha domain might be involved in stabilizing junctions. Plays a role in the regulation of cell migration by targeting CDC42BPB to the leading edge of migrating cells. Source: Recombinant protein corresponding to aa1633-1769 from canine TJP1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~18.7kD Amino Acid Sequence: VVATARGVFNNNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSGDPKTWQNKCLPGDPNYLVGANCVSVLIDHF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten