TP53AIP1, Recombinant, Human, aa1-108, GST-Tag (p53-regulated Apoptosis-inducing Protein 1)

Artikelnummer: USB-375638
Artikelname: TP53AIP1, Recombinant, Human, aa1-108, GST-Tag (p53-regulated Apoptosis-inducing Protein 1)
Artikelnummer: USB-375638
Hersteller Artikelnummer: 375638
Alternativnummer: USB-375638-20,USB-375638-100,USB-375638-1
Hersteller: US Biological
Kategorie: Molekularbiologie
May play an important role in mediating p53/TP53-dependent apoptosis. Source: Recombinant protein corresponding to aa1-108 from human TP53AIP1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.3kD Amino Acid Sequence: MGSSSEVSFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSPCSENRDGLLPATAPGRLCSHRGADIPSFQTHQDPVTASGSSELHADCPQFRALDRAGN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 38.3
UniProt: Q9HCN2
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.