TPD52L1, Recombinant, Human, aa1-144, GST-Tag (Tumor Protein D53)

Artikelnummer: USB-375641
Artikelname: TPD52L1, Recombinant, Human, aa1-144, GST-Tag (Tumor Protein D53)
Artikelnummer: USB-375641
Hersteller Artikelnummer: 375641
Alternativnummer: USB-375641-20, USB-375641-100, USB-375641-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa1-144 from human TPD52L1, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~49.4kD Amino Acid Sequence: MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRNSPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 49.4
UniProt: Q16890
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.