Tsc22d4, Recombinant, Mouse, aa1-387, His-Tag (TSC22 Domain Family Protein 4)

Artikelnummer: USB-375695
Artikelname: Tsc22d4, Recombinant, Mouse, aa1-387, His-Tag (TSC22 Domain Family Protein 4)
Artikelnummer: USB-375695
Hersteller Artikelnummer: 375695
Alternativnummer: USB-375695-20, USB-375695-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Transcriptional repressor. Source: Recombinant protein corresponding to aa1-387 from mouse Tsc22d4, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~42kD Amino Acid Sequence: MSGGKKKSSFQITSVTTDYEGPGSPGASDSPVPPALAGPPPRLPNGDPNPDPGGRGTPRNGSPPPGAPASRFRVVKLPQGLGEPYRRGRWTCVDVYERDLEPPSFGRLLEGIRGASGGTGGRSLDSRLELASLGISTPIPQPGLSQGPTSWLRPPPTSPGPQARSFTGGLGQLAGPGKAKVETPPLSASPPQQRPPGPGTGDSAQTLPSLRVEVESGGSAAATPPLSRRRDGAVRLRMELVAPAETGKVPPTDSRPNSPALYFDASLVHKSPDPFGAAAAQSLSLARSMLAISGHLDSDDDSGSGSLVGIDNKIEQAMDLVKSHLMFAVREEVEVLKEQIRDLAERNAALEQENGLLRALASPEQLAQLPSSGLPRLGPSAPNGPSI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 42
UniProt: Q9EQN3
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.