TTF1, Recombinant, Human, aa11-242, His-Tag (Transcription Termination Factor 1)

Artikelnummer: USB-375704
Artikelname: TTF1, Recombinant, Human, aa11-242, His-Tag (Transcription Termination Factor 1)
Artikelnummer: USB-375704
Hersteller Artikelnummer: 375704
Alternativnummer: USB-375704-20,USB-375704-100,USB-375704-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Multifunctional nucleolar protein that terminates ribosomal gene transcription, mediates replication fork arrest and regulates RNA polymerase I transcription on chromatin. Plays a dual role in rDNA regulation, being involved in both activation and silencing of rDNA transcription. Interaction with BAZ2A/TIP5 recovers DNA-binding activity. Source: Recombinant protein corresponding to aa11-242 from human TTF1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~30.7kD Amino Acid Sequence: HTPVSDKKKKKCSIHKERPQKHSHEIFRDSSLVNEQSQITRRKKRKKDFQHLISSPLKKSRICDETANATSTLKKRKKRRYSALEVDEEAGVTVVLVDKENINNTPKHFRKDVDVVCVDMSIEQKLPRKPKTDKFQVLAKSHAHKSEALHSKVREKKNKKHQRKAASWESQRARDTLPQSESHQEESWLSVGPGGEITELPASAHKNKSKKKKKKSSNREYETLAMPEGSQA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 30.7
UniProt: Q15361
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.